eYFP MDPNSIVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVP WPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDT LVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSRAA ALESAWSHPQFEKGGGSGGGSGGGSWSHPQFEK super-folder YFP MDPNSVSKGEELFTGVVPILVELDGDVNGHKFRVSGEGEGDATNGKLTLKFICTTGKLPVPW PTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTL VNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGGVQLADH
نویسندگان
چکیده
منابع مشابه
A Genetically-Encoded YFP Sensor with Enhanced Chloride Sensitivity, Photostability and Reduced pH Interference Demonstrates Augmented Transmembrane Chloride Movement by Gerbil Prestin (SLC26a5)
BACKGROUND Chloride is the major anion in cells, with many diseases arising from disordered Cl- regulation. For the non-invasive investigation of Cl- flux, YFP-H148Q and its derivatives chameleon and Cl-Sensor previously were introduced as genetically encoded chloride indicators. Neither the Cl- sensitivity nor the pH-susceptibility of these modifications to YFP is optimal for precise measureme...
متن کاملSuper-Resolution Imaging Conditions for enhanced Yellow Fluorescent Protein (eYFP) Demonstrated on DNA Origami Nanorulers
Photostability is one of the crucial properties of a fluorophore which strongly influences the quality of single molecule-based super-resolution imaging. Enhanced yellow fluorescent protein (eYFP) is one of the most widely used versions of fluorescent proteins in modern cell biology exhibiting fast intrinsic blinking and reversible photoactivation by UV light. Here, we developed an assay for st...
متن کاملQuantitative super-resolution single molecule microscopy dataset of YFP-tagged growth factor receptors
Background Super-resolution single molecule localization microscopy (SMLM) is a method for achieving resolution beyond the classical limit in optical microscopes (approx. 200 nm laterally). Yellow fluorescent protein (YFP) has been used for super-resolution single molecule localization microscopy, but less frequently than other fluorescent probes. Working with YFP in SMLM is a challenge because...
متن کاملDistinct functions of chloroplast FtsZ 1 and FtsZ 2 in Z - ring structure and remodeling Allan
The Rockefeller University Press $30.00 J. Cell Biol. www.jcb.org/cgi/doi/10.1083/jcb.201205114 Cite by DOI: 10.1083/jcb.201205114 JCB 1 of 15 Correspondence to Katherine W. Osteryoung: [email protected] Abbreviations used in this paper: eCFP, enhanced CFP; eYFP, enhanced YFP; PCC, Pearson’s correlation coefficient; PMT, photomultiplier tube; t1/2, half-time of fluorescence recovery; WT, wild ty...
متن کاملGene Expression Pattern and Protein Localization of Arabidopsis Phospholipase D Alpha 1 Revealed by Advanced Light-Sheet and Super-Resolution Microscopy
Phospholipase D alpha 1 (PLDα1, At3g15730) and its product phosphatidic acid (PA) are involved in a variety of cellular and physiological processes, such as cytoskeletal remodeling, regulation of stomatal closure and opening, as well as biotic and abiotic stress signaling. Here we aimed to study developmental expression patterns and subcellular localization of PLDα1 in Arabidopsis using advance...
متن کامل